SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PPX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PPX4
Domain Number 1 Region: 392-493
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  H2PPX4
Domain Number - Region: 89-164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0575
Family Myosin rod fragments 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PPX4
Sequence length 495
Comment (tr|H2PPX4|H2PPX4_PONAB) Scavenger receptor class A member 5 {ECO:0000256|HAMAP-Rule:MF_03070} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0005238 OC=Catarrhini; Hominidae; Pongo.
Sequence
MENKAMYLHTVSNCDTSSICEDSFDGRSLSKLNLCEDGPCHKRRASICCTQLGSLSALKH
AVLGLYLLVFLILVGIFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQAD
LTEQVWKVQDALQNQSDSLLALAGAVQRLEGALWGLQAQAVQTEQAVALLRDRTGQQSDT
AQLELYQLQVESNSSQLLLRRHAGLLDRLARRVGILGEELADVGGVLRGLNHSLSYDVAL
HRTRLQDLRVLVSNASEDTRRLRLAHVGMELQLKQELAMLNAVTEDLRLKDWEHSIALRN
ISLAKGPPGPKGDQGDEGKEGRPGIPGLPGLRGLPGERGTPGLPGPKGDDGKLGATGPMG
MRGFKGDRGPKGEKGEKGDRAGDASGAEAPMMIRLVNGSGPHEGRVEVYHDRRWGTVCDD
GWDKKDGDVVCRMLGFRGVEEVYRTARFGQGTGRIWMDDVACKGTEETIFRCSFSKWGVT
NCGHAEDASVTCNRH
Download sequence
Identical sequences H2PPX4
ENSPPYP00000020702 ENSPPYP00000020702 9600.ENSPPYP00000020702 XP_002818988.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]