SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PPZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PPZ6
Domain Number 1 Region: 64-151,221-352
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.67e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000207
Further Details:      
 
Domain Number 2 Region: 358-471
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.7e-37
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PPZ6
Sequence length 472
Comment (tr|H2PPZ6|H2PPZ6_PONAB) Glutathione-disulfide reductase {ECO:0000313|Ensembl:ENSPPYP00000020725} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=GSR OC=Catarrhini; Hominidae; Pongo.
Sequence
MALLPRALSAGAGPSWRRAARAFRGFPLLLPEPAALTRALSSAMACRQEPQPQGPLPAAG
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFPSCEGKFNWRIIKEKRDAYVSRLNTIYENNLTKASLGITSDGFFQLEEL
PSRSIIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRNFDSMISTNCTEELENAGVEVL
KFSQVKEVKKTSSGLEVSMVTAVPGTLPVMTMIPDVDCLLWAIGRDPNTKGLSLNKLGIQ
TDDKGHILVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNN
IPTVVFSHPPIGTVGLTEDEAIHKYGKENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANK
EEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences H2PPZ6
9600.ENSPPYP00000020725 ENSPPYP00000020725 ENSPPYP00000020725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]