SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PQM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PQM4
Domain Number 1 Region: 112-164
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000955
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 50-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PQM4
Sequence length 304
Comment (tr|H2PQM4|H2PQM4_PONAB) Hairy/enhancer-of-split related with YRPW motif protein 1 {ECO:0000313|Ensembl:ENSPPYP00000020968} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0020631 OC=Catarrhini; Hominidae; Pongo.
Sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPW
GTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV
LPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE
IGAF
Download sequence
Identical sequences H2PQM4 K7D7U5 Q9Y5J3
NP_036390.3.87134 NP_036390.3.92137 XP_003831331.1.60992 XP_004047233.1.27298 XP_519823.2.37143 ENSPPYP00000020968 ENSPPYP00000020968 ENSP00000346761 gi|105990528|ref|NP_036390.3| 9600.ENSPPYP00000020968 ENSP00000346761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]