SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PRG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PRG3
Domain Number 1 Region: 71-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.5e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PRG3
Sequence length 200
Comment (tr|H2PRG3|H2PRG3_PONAB) Scleraxis bHLH transcription factor {ECO:0000313|Ensembl:ENSPPYP00000021273} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=SCX OC=Catarrhini; Hominidae; Pongo.
Sequence
MSFATLRPAPPGRYLYPESPLSEDEDRGSDSSGSDEKPCRVHAARCGLQGARRRAGGRRA
GGGGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLAS
SYISHLGNVLLAGEACGDGQPCHSGPAFFHAARAGSPPPPPPPPPARDGENTQPKQICTF
CLSNQRKLSKDRDRKTAIRS
Download sequence
Identical sequences H2PRG3
ENSPPYP00000021273 ENSPPYP00000021273 9600.ENSPPYP00000021273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]