SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PRI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PRI1
Domain Number 1 Region: 193-415
Classification Level Classification E-value
Superfamily RNI-like 7.46e-23
Family 28-residue LRR 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PRI1
Sequence length 493
Comment (tr|H2PRI1|H2PRI1_PONAB) Leucine rich repeat containing 14 {ECO:0000313|Ensembl:ENSPPYP00000021291} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0050887 OC=Catarrhini; Hominidae; Pongo.
Sequence
MHTLVFLSTRQVLQCQPAACQALPLLPRELFPLLFKVAFMDKKTVVLRELVHTWPFPLLS
FQQLLQECAHCSRALLQERPSTESMQAVILGLTARLHTSEPGASTQPLCRKHALRVLDMT
GLLDDGVEQDPGTMSMWDCTAAVARTCIAQQQGGAAEPGPAPIPVEVRVDLRVNRASYAF
LREALRSSVGSPLRLCCRDLRAEDLPMRNTVALLQLLDAGCLRRVDLRFNNLGLRGLSVI
IPHVARFQHLASLRLHYVHGDSRQPSVDGEDNFRYFLAQMGRFTCLRELSMGSSLLSGRL
DQLLSTLQSPLESLELAFCALLPEDLRFLARSPHAAHLKKLDLSGNDLSGSQLAPFQGLL
QASAATLLHLELTECQLADTQLLATLPILTQCASLRYLGLYGNPLSMAGLKELLRDSVAQ
AELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVEAELHQLLLASGRAHVLWTT
DIYGRLAADYFSL
Download sequence
Identical sequences G3REJ1 H2PRI1 K6ZV24 Q15048
ENSPPYP00000021291 gi|7661860|ref|NP_055480.1| HR6068 ENSP00000292524 ENSP00000434768 ENSPPYP00000021291 ENSGGOP00000013979 9600.ENSPPYP00000021291 9606.ENSP00000292524 NP_001258965.1.87134 NP_001258965.1.92137 NP_055480.1.87134 NP_055480.1.92137 XP_004047749.1.27298 XP_005272415.1.92137 XP_005272416.1.92137 XP_009242470.1.23681 XP_009242471.1.23681 XP_009454445.2.37143 XP_016815648.1.37143 XP_016815649.1.37143 XP_016815651.1.37143 XP_018887793.1.27298 XP_018887795.1.27298 XP_018887796.1.27298 ENSGGOP00000013979 ENSP00000292524 ENSP00000434768 ENSP00000292524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]