SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PSM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PSM3
Domain Number 1 Region: 26-500
Classification Level Classification E-value
Superfamily Sema domain 1.18e-170
Family Sema domain 0.000000000000013
Further Details:      
 
Domain Number 2 Region: 502-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000114
Family Plexin repeat 0.0000388
Further Details:      
 
Domain Number 3 Region: 563-650
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000456
Family I set domains 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PSM3
Sequence length 862
Comment (tr|H2PSM3|H2PSM3_PONAB) Semaphorin 4D {ECO:0000313|Ensembl:ENSPPYP00000021695} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0008965 OC=Catarrhini; Hominidae; Pongo.
Sequence
MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVRLVQFHEPDIYNYSALLLSENKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLST
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTEVAV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNVLRDVFVLR
SPGLKVPVFYALFAPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNG
PVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDQTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSS
KKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQTESPSR
GLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNLARVFWKFQNGVLKAESPK
YGLMGRKNLLIFNLSEGDSGVYQCLSEERVKNKTVFQVVAKHVLEVKVVPKPVVAPTLSV
VQTEGSRIATKVLVASTQGSSPPTPAVQATSSGAITLPPKPAPTGTSCEPKIVINTVPQL
HPEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSALLIGKKKPKS
DFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD
Download sequence
Identical sequences H2PSM3
XP_002819988.1.23681 ENSPPYP00000021695 9600.ENSPPYP00000021695 ENSPPYP00000021695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]