SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PSU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PSU6
Domain Number 1 Region: 134-207
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.75e-27
Family DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain 0.00000772
Further Details:      
 
Domain Number 2 Region: 98-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000143
Family DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PSU6
Sequence length 273
Comment (tr|H2PSU6|H2PSU6_PONAB) XPA, DNA damage recognition and repair factor {ECO:0000313|Ensembl:ENSPPYP00000021770} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0008777 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAATDGALPEAAALEQPAELPATVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHEPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
Download sequence
Identical sequences H2PSU6
ENSPPYP00000021770 ENSPPYP00000021770 XP_002820062.1.23681 9600.ENSPPYP00000021770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]