SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PTX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PTX7
Domain Number 1 Region: 54-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000103
Family HLH, helix-loop-helix DNA-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PTX7
Sequence length 293
Comment (tr|H2PTX7|H2PTX7_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000022161} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MASRCSEPDPEVSGVPTVRGFNGSSLSGALSCCEDSAQGSGPPKGPTVAEGPSSCLRRNV
IGERERRKRISLSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILAS
SKEMWHSLQEDVLQLTLSSQIQAGVPDAGTGASSGTQTPDVKAFLESPWSQDLASASPEP
LPHILASSRQWDPANCTSPGTDKCEALLGLCQVRGGLPPFSGPSSLAPWPPGRSLPKSVR
PPLSWPPFSQQQTLPVMSREALGWLGQAGPLALGAAPLGEPAKEDPMFAQEAR
Download sequence
Identical sequences H2PTX7
ENSPPYP00000022161 ENSPPYP00000022161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]