SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PV94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PV94
Domain Number 1 Region: 78-162
Classification Level Classification E-value
Superfamily HMG-box 5.63e-25
Family HMG-box 0.0000252
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily HMG-box 2.23e-20
Family HMG-box 0.0000212
Further Details:      
 
Weak hits

Sequence:  H2PV94
Domain Number - Region: 176-202
Classification Level Classification E-value
Superfamily ARM repeat 0.0132
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PV94
Sequence length 210
Comment (tr|H2PV94|H2PV94_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000022638} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MGKRDPKKPRSKMSSYAFFVQTYQEEHKKKQLDASVSFSEFSKNCSERWKTMSVKEKGKC
EDMAKADKACYEREMKIYPKGETKKKFKDLNAPKMPPSAFFLFCSEYHPKIRGEHPVQST
SDIVKKLGGMWNNTAADEKQPHEKKAAKLKEKCKKDIAAYQAKGKPDAKGVVKVEKSKKK
KEEEEDEEDEDGEEEDEDDDDEKKIEMDGS
Download sequence
Identical sequences H2PV94
ENSPPYP00000022638 ENSPPYP00000022638 9600.ENSPPYP00000022638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]