SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PW67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2PW67
Domain Number - Region: 271-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000391
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PW67
Sequence length 301
Comment (tr|H2PW67|H2PW67_PONAB) CPX chromosome region, candidate 1 {ECO:0000313|Ensembl:ENSPPYP00000022974} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CPXCR1 OC=Catarrhini; Hominidae; Pongo.
Sequence
MSSPTKEGSDTAGNAHKNSENEPSNDFSTDIESPSADPNMIYQVETNPINREPDTATSQE
DVVPQAAENSELETEIQKDQREEDIKEESLLLQIPIPRKLVSHKPLNDRSRSHSGKVEMK
ANNFRINHKTRFRLSTSWRVPFISNHEIRSMILRLLCDRYFFQAAGCQNTMWVKQKYIAC
LYHPNSFTHHERAIIFRRPSRVHYYRPLTERMTSGKFFKSTDTKGKCRFRAIVRSVLFVS
QMQIQSIFNRKGFVDILRYSHTMKVMIINTNNGWKYFCPICGRLFNTYSELRQHSWSSSG
N
Download sequence
Identical sequences H2PW67
9600.ENSPPYP00000022974 ENSPPYP00000022974 ENSPPYP00000022974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]