SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PXW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PXW9
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 80-123
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000209
Family Hairy Orange domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PXW9
Sequence length 173
Comment (tr|H2PXW9|H2PXW9_PANTR) Hes family bHLH transcription factor 2 {ECO:0000313|Ensembl:ENSPTRP00000000160} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0035113 OC=Catarrhini; Hominidae; Pan.
Sequence
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVL
EMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLW
RRAASATLDGGRAGDSSGPSAPAPAPASAPEPASAPVPSPPSPPCGPGLWRPW
Download sequence
Identical sequences G3SAB1 H2PXW9 Q9Y543
NP_061962.2.87134 NP_061962.2.92137 XP_001156221.3.37143 XP_016808605.1.37143 XP_018865955.1.27298 ENSP00000367067 ENSP00000367065 ENSP00000367065 gi|63055047|ref|NP_061962.2| 9598.ENSPTRP00000000160 9606.ENSP00000367065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]