SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PYP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PYP4
Domain Number 1 Region: 38-143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-16
Family Growth factor receptor domain 0.0019
Further Details:      
 
Domain Number 2 Region: 147-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000589
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PYP4
Sequence length 263
Comment (tr|H2PYP4|H2PYP4_PANTR) RSPO1 isoform 4 {ECO:0000313|EMBL:PNI52319.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0025370 OC=Catarrhini; Hominidae; Pan.
Sequence
MRLGLCVVALVLSWTHLTISSWGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYL
HKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKKKLCGFRRGSEERTRRVL
HAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSR
RRKGQQQQQQQGTVGPLTSAGPA
Download sequence
Identical sequences H2PYP4
ENSPTRP00000000970 XP_001169700.1.37143 XP_009452275.1.37143 9598.ENSPTRP00000000970 ENSPTRP00000000970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]