SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PZ38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PZ38
Domain Number 1 Region: 67-373
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.34e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0012
Further Details:      
 
Domain Number 2 Region: 362-472
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.6e-17
Family Anticodon-binding domain of Class II aaRS 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PZ38
Sequence length 475
Comment (tr|H2PZ38|H2PZ38_PANTR) Prolyl-tRNA synthetase 2, mitochondrial {ECO:0000313|Ensembl:ENSPTRP00000001345} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=PARS2 OC=Catarrhini; Hominidae; Pan.
Sequence
MEGLLTRCRALPALATCSHQLSGYVPCRFHHCAPRRGRRLLLSRVFQPQNLREDRVLSLQ
DKSDDLTCKSQRLMLQVGLIYPASPGCYHLLPYTVRAMEKLVRVIDQEMQAIGGQKVNMP
SLSPAELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAITALIASQKKLSYKQLPFL
LYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAAQQTYSLVCDAYCSLFNKLGLP
FVKVQADVGTIGGTVSHEFQLPVDIGEDRLAICPRCSFSANMETLDLSQMNCPACQGPLT
KTKGIEVGHTFYLGTKYSSIFNAQFTNVCGKPTLAEMGCYGLGVTRILAAAIEVLSTEDC
VRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEAVPQLHGEVLLDDRTHLTIGN
RLKDANKFGYPFVIIAGKRALEDPAHFEVWCQNTGEVAFLTKDGVMDLLTQVQTV
Download sequence
Identical sequences H2PZ38
XP_003815038.1.60992 XP_513427.3.37143 ENSPTRP00000001345 9598.ENSPTRP00000001345 ENSPTRP00000001345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]