SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PZW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PZW8
Domain Number 1 Region: 301-599
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.04e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000215
Further Details:      
 
Domain Number 2 Region: 122-300
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.79e-44
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00067
Further Details:      
 
Domain Number 3 Region: 601-709
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 5.89e-26
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000698
Family TGS domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PZW8
Sequence length 718
Comment (tr|H2PZW8|H2PZW8_PANTR) Threonyl-tRNA synthetase 2, mitochondrial (Putative) {ECO:0000313|EMBL:JAA00801.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0046951 OC=Catarrhini; Hominidae; Pan.
Sequence
MALYQRWRCLRLQGLQACRLHTAVVSTPPRWLAERLGLFEELWAAQVKRLASMAQKEPRT
IKISLPGGQKIDAVAWNTTPYQLARQISSTLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGKERTIRGSELPV
LERICQELTAAARPFRRLEASRDQLRQLFKDNPFKLHLIEEKVTGPTATVYGCGTLVDLC
QGPHLRHTGQIGGLKLLSNSSSLWRSSGAPETLQRVSGISFPTTELLRAWEAWREEAELR
DHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYAHRGFSEVKTPTLFSTK
LWEQSGHWEHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRP
RSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLR
SVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKI
DVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLA
ESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRA
QLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF
Download sequence
Identical sequences H2PZW8
ENSPTRP00000002129 9598.ENSPTRP00000002129 ENSPTRP00000002129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]