SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q0H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q0H6
Domain Number 1 Region: 17-321
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-54
Family Protein kinases, catalytic subunit 0.0017
Further Details:      
 
Domain Number 2 Region: 317-406
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.87e-18
Family Canonical RBD 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2Q0H6
Sequence length 419
Comment (tr|H2Q0H6|H2Q0H6_PANTR) UHMK1 isoform 3 {ECO:0000313|EMBL:PNI48383.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0027892 OC=Catarrhini; Hominidae; Pan.
Sequence
MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPG
TSGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSE
LLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGL
SFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMK
LKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALC
SPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQKYGPVVSL
LVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL
Download sequence
Identical sequences H2Q0H6
XP_001174268.1.37143 9598.ENSPTRP00000002674 ENSPTRP00000002674 ENSPTRP00000002674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]