SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q1K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q1K9
Domain Number 1 Region: 124-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000121
Family Complement control module/SCR domain 0.000016
Further Details:      
 
Domain Number 2 Region: 23-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000681
Family Complement control module/SCR domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2Q1K9
Sequence length 272
Comment (tr|H2Q1K9|H2Q1K9_PANTR) Interleukin-2 receptor subunit alpha {ECO:0000313|Ensembl:ENSPTRP00000003829} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0036087 OC=Catarrhini; Hominidae; Pan.
Sequence
MDSYLLMWGLLTLIMVPGCQAELCDDDPPEITHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQTVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLITTTDFQIQTEMAATMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
Download sequence
Identical sequences H2Q1K9
ENSPTRP00000003829 XP_009456144.1.37143 ENSPTRP00000003829 9598.ENSPTRP00000003829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]