SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q2T1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q2T1
Domain Number 1 Region: 49-155
Classification Level Classification E-value
Superfamily L domain-like 8.5e-21
Family Ngr ectodomain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2Q2T1
Sequence length 530
Comment (tr|H2Q2T1|H2Q2T1_PANTR) Leucine rich repeat containing 27 {ECO:0000313|Ensembl:ENSPTRP00000005408} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=LRRC27 OC=Catarrhini; Hominidae; Pan.
Sequence
MEESSSYEVPSVAAADLEEGAGQTRSLPATPSKDVHKGVGGIIFSSSPILDLSESGLCRL
EEVFRIPSLQQLHLQRNALCVIPQDFFQLLPNLTWLDLRCNRIKALPSGIGAHKHLKTLL
LERNPIKMLPVELGSVTTLKALNLRHCPLEFPPQLVVQKGLVAIQRFLRVWAVEHSFPRN
PTSQEAPPVREMTLCDLSSPGLELSGDHASNQGAVNAQDPEGAVMKEKAGFLPPVEKPDL
SELRKSADSSENWPSEEEIRRFWKLRQEIVEHVKADVLGDQLLTRELPPNLKATLNIEKE
LPKPRHVFRRKTASSRSILPDLLSPYQIAIRAKRLEESRAAALRELQEKQALMEQQRREK
RALQEWRERAQRMRKRKEELSKLLPLRRSMVASKTPSATDLIDNGKVPLNPAGKMKPSKE
KSPQASKETRALQERNLEEKIKQHVPQMHEQRRFHGQAPLEEMRKAAEDLEIAAELQDEV
LKPKLGLTLKKDRRRAALTGNLSLGLPAAQPQNTFFNTKYGESGSVRRYQ
Download sequence
Identical sequences H2Q2T1
9598.ENSPTRP00000005408 XP_003951833.1.37143 XP_003951834.1.37143 XP_009457820.1.37143 ENSPTRP00000005408 ENSPTRP00000005408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]