SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q303 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q303
Domain Number 1 Region: 295-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-48
Family SPRY domain 0.0000279
Further Details:      
 
Domain Number 2 Region: 4-87
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-24
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 91-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.43e-16
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2Q303
Sequence length 488
Comment (tr|H2Q303|H2Q303_PANTR) TRIM34 isoform 2 {ECO:0000313|EMBL:PNI79695.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0005948 OC=Catarrhini; Hominidae; Pan.
Sequence
MASKILLNVQEEVTCPICLELLTEPLSLDCGHSLCRACITVSNKEAVTSVGGKSSCPVCG
ISYSFEHLQANQHLANIVERLKEVKLSPDNGKKRDLCDHHGEKLLLFCKEDRKVICWLCE
RSQEHRGHHTVLTEEVFKECQEKLQAVLKRLKKEEEEAEKLEADIREEKTSWKYQVQTER
QRIQTEFDQLRSILNNEEQRELQRLEEEEKKTLDKFAEAEDELVQQKQLVRELISDVECR
SQWSTMELLQDMSGIMKWSEIWRLKKPKTVSKKLKTVFHAPDLSRMLQMFRELTAVRCYW
VDVTLNSVNLNLNLVLSEDQRQVISVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTA
WILGVYCRTYSRHMKYVVRRCANRQNLYSKYRPLFGYWVIGLQNKCKYGVFEESLSSDPE
VLTLSMAVPPCRVGVFLDYEAGIVSFFNVTSHGSLIYQFSKCCFSQPVYPYFNPWNCPAP
MTLCPPSS
Download sequence
Identical sequences H2Q303
NP_001192106.1.37143 ENSPTRP00000005727 ENSPTRP00000005727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]