SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q3D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q3D2
Domain Number 1 Region: 53-106
Classification Level Classification E-value
Superfamily GLA-domain 2.02e-19
Family GLA-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2Q3D2
Sequence length 226
Comment (tr|H2Q3D2|H2Q3D2_PANTR) Proline rich and Gla domain 4 {ECO:0000313|Ensembl:ENSPTRP00000091171} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0005457 OC=Catarrhini; Hominidae; Pan.
Sequence
MFTLLVLLSQLPTVTLGFPHCARGPKASKHAGEEVFTSKEEANFFIHRRLLYNRFDLELF
TPGNLERECNEELCNYEEAREIFVDEDKTIAFWQEYSAKGPTTKSDGNREKIDVMGLLTG
LIAAGVFLVIFGLLGYYLCMTKCNGLQHPCSSAVYERGRHTPSIIFRRPEEAALSPLPPS
VEDAGLPSYEQAVALTRKHSVSPPPPYPGHTKGFRVFKKSMSLPSH
Download sequence
Identical sequences H2Q3D2
9598.ENSPTRP00000006044 ENSPTRP00000006044 ENSPTRP00000006044 XP_009458462.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]