SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q3Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q3Y1
Domain Number 1 Region: 45-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.9e-42
Family Galectin (animal S-lectin) 0.00019
Further Details:      
 
Domain Number 2 Region: 209-335
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-18
Family Galectin (animal S-lectin) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2Q3Y1
Sequence length 336
Comment (tr|H2Q3Y1|H2Q3Y1_PANTR) Galectin {ECO:0000256|RuleBase:RU102079} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0031017 OC=Catarrhini; Hominidae; Pan.
Sequence
MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLRAG
KMVVLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQRE
ARWPHLPLRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAV
GFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFT
VSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKL
ALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS
Download sequence
Identical sequences H2Q3Y1
ENSPTRP00000006540 XP_001161075.1.37143 ENSPTRP00000006540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]