SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q4H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q4H3
Domain Number 1 Region: 136-472
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.39e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000379
Further Details:      
 
Domain Number 2 Region: 38-121
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000364
Family Anticodon-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2Q4H3
Sequence length 477
Comment (tr|H2Q4H3|H2Q4H3_PANTR) Asparaginyl-tRNA synthetase 2, mitochondrial (Putative) {ECO:0000313|EMBL:JAA15479.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=NARS2 OC=Catarrhini; Hominidae; Pan.
Sequence
MLGVRCLLRSVRFCSSAPFPKHKPSAKLSVRDALGAQNASGERIKIQGWIRSVRSQKEVL
FLHVNDGSSLESLQVVADSGLDSRELTFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIGN
CDAKDFPIKYKERHPLEYLRQHPHFRCRTNVLSSILRIRSEATAAIHSFFKDSGFVHIHT
PIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGP
TFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHK
FIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCG
NIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLA
RSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCVLGVDNIKDVIPFPRFPHSCLL
Download sequence
Identical sequences H2Q4H3
9598.ENSPTRP00000007084 XP_522122.2.37143 ENSPTRP00000007084 ENSPTRP00000007084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]