SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q5M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q5M4
Domain Number 1 Region: 41-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000628
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 125-172
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000183
Family Hairy Orange domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2Q5M4
Sequence length 482
Comment (tr|H2Q5M4|H2Q5M4_PANTR) Basic helix-loop-helix family member e41 {ECO:0000313|Ensembl:ENSPTRP00000008155} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0019021 OC=Catarrhini; Hominidae; Pan.
Sequence
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLL
TQQVPLSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDS
GYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKLDSRGGGSGGGPGGGAAAA
AAALLGPDPAAAAALLRPDAALLSSLVAFGGGGGAPFPQPAAAAAPFCLPFCFLSPSAAA
AYVQPFLDKSGLEKYLYPAAAAAPFPLLYPGIPAPAAAAAAAAAAAAAAAAFPCLSSVLS
PPPEKAGAAAATLLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKE
AP
Download sequence
Identical sequences A0A024RAV8 H2Q5M4 Q9C0J9
ENSP00000242728 ENSP00000242728 gi|13540521|ref|NP_110389.1| 9598.ENSPTRP00000008155 9606.ENSP00000242728 ENSPTRP00000008155 ENSPTRP00000008155 NP_110389.1.87134 NP_110389.1.92137 XP_520805.2.37143 ENSP00000242728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]