SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q5R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q5R2
Domain Number 1 Region: 156-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-74
Family Protein kinases, catalytic subunit 0.0000615
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-38
Family DEATH domain, DD 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2Q5R2
Sequence length 460
Comment (tr|H2Q5R2|H2Q5R2_PANTR) Interleukin-1 receptor-associated kinase 4 {ECO:0000313|EMBL:JAA27338.1, ECO:0000313|Ensembl:ENSPTRP00000008285} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0027025 OC=Catarrhini; Hominidae; Pan.
Sequence
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAVTV
QQKQMPFYDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVETMYSVASECLHEKKNKRPDIKKVQQLLQEMTAS
Download sequence
Identical sequences H2Q5R2
ENSPTRP00000008285 9598.ENSPTRP00000008285 ENSPTRP00000008285 XP_001166075.1.37143 XP_001166114.1.37143 XP_009423848.1.37143 XP_016779093.1.37143 XP_016779094.1.37143 XP_016779096.1.37143 XP_016779097.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]