SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q691 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q691
Domain Number 1 Region: 30-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-38
Family SPRY domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2Q691
Sequence length 207
Comment (tr|H2Q691|H2Q691_PANTR) SPRYD4 isoform 1 {ECO:0000313|EMBL:PNI90206.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0046625 OC=Catarrhini; Hominidae; Pan.
Sequence
MALLFARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDTGVKYGLVGLE
PTKVALNVERFREWAVVLADTAVTSGRHYWEVTVKRSQQFRIGVADVDMSRDSCIGVDDR
SWVFTYAQRKWYTMLANEKAPVEGIGQPEKVGLLLEYEAQKLSLVDVSQVSVVHTLQTDF
RGPVVPAFALWDGELLTHSGLEVPEGL
Download sequence
Identical sequences G3RKA5 H2NHQ5 H2Q691
ENSPPYP00000005313 gi|46409324|ref|NP_997227.1| ENSPTRP00000008678 ENSPTRP00000008678 ENSPPYP00000005313 NP_997227.1.87134 NP_997227.1.92137 XP_001168831.1.37143 XP_002823448.1.23681 XP_004053429.1.27298 HR6583 ENSP00000338034 9598.ENSPTRP00000008678 9600.ENSPPYP00000005313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]