SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2Q6V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q6V6
Domain Number 1 Region: 12-138
Classification Level Classification E-value
Superfamily DNA clamp 1.71e-16
Family DNA polymerase processivity factor 0.026
Further Details:      
 
Weak hits

Sequence:  H2Q6V6
Domain Number - Region: 171-240
Classification Level Classification E-value
Superfamily DNA clamp 0.0974
Family DNA polymerase processivity factor 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2Q6V6
Sequence length 429
Comment (tr|H2Q6V6|H2Q6V6_PANTR) RAD9B isoform 3 {ECO:0000313|EMBL:PNI64709.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0015922 OC=Catarrhini; Hominidae; Pan.
Sequence
MAAMLKCVMSGSQVKVFGKAVQALSRISDEFWLDPSKKGLALRCVNSSRSAYGCVLFSPV
FFQHYQWSALVKMSENELDTTLNLKCKLGMKSILPIFRCLNSLERNIEKCRIFTRSDKCK
VVIQFFYRHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVT
LAVTPLNFCLKSSNEESMDLSNAVYSEMFVGSDEFDFFQIGMDTEITFCFKELKGILTFS
EATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCLSQKRKRSDL
IEKKAGKNVTGQALECISRKAAPRRLYPKETLTNISALENCGSPAMKRVDGDVSEVSESS
VSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDMNNVCCRKEFNG
SDAKYFCII
Download sequence
Identical sequences H2Q6V6
ENSPTRP00000009244 ENSPTRP00000009244 XP_001142878.1.37143 XP_003832530.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]