SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q7P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q7P4
Domain Number 1 Region: 383-601
Classification Level Classification E-value
Superfamily L domain-like 3.63e-36
Family Ngr ectodomain-like 0.0079
Further Details:      
 
Domain Number 2 Region: 73-284
Classification Level Classification E-value
Superfamily L domain-like 2.83e-34
Family Ngr ectodomain-like 0.0018
Further Details:      
 
Weak hits

Sequence:  H2Q7P4
Domain Number - Region: 787-891
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2Q7P4
Sequence length 958
Comment (tr|H2Q7P4|H2Q7P4_PANTR) SLITRK5 isoform 1 {ECO:0000313|EMBL:PNI81281.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0004459 OC=Catarrhini; Hominidae; Pan.
Sequence
MHTCCPPVTLEQDLHRKMHSWMLQTLAFAVTSLVLSCAETIDYYGEICDNACPCEEKDGI
LTVSCENRGIISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASILHLGSNVIQDI
ETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLENLEYLQVDYNYISVIEPNAFGKLHLLQ
VLILNDNLLSSLPNNLFRFVPLTHLDLRGNRLKLLPYVGLLQHMDKVVELQLEENPWNCS
CELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRRLISDYEMRPQTPL
STTGYLHTTPASVNSVATSSSAVYKPPLKPPKGTRQPNKPRVRPTSRQPSKDLGYSNYGP
SIAYQTKSPVPLECPTACTCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENY
IAVVRRTDFLEATGLDLLHLGNNRISMIQDRAFGDLTNLRRLYLNGNRIERLSPELFYGL
QSLQYLFLQYNLIREIQSGTFDPVPNLQLLFLNNNLLQAMPSGVFSGLTLLRLNLRSNHF
TSLPVSGVLDQLKSLIQIDLHDNPWDCTCDIVGMKLWVEQLKVGVLVDEVICKAPKKFAE
TDMRSIKSELLCPDYSDVVVSTPTPSSIQVPARTSAVTPAVRLNSTGAPASLGAGGGASS
VPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYGGG
GGTGGHPHAHVHHRGPALPKVKTPAGHVYEYIPHPLGHMCKNPIYRSREGNSVEDYKDLH
ELKVTYSSNHHLQQQQQPPPPPQQPQQQPPPQLQLQPGEEERRESHHLRSPAYSVSTIEP
REDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKFPCSPAAYTFSPNYDLRRPHQ
YLHPGAGDSRLREPVLYSPPSAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF
Download sequence
Identical sequences H2Q7P4
XP_003314232.1.37143 XP_003832064.1.60992 XP_009425401.1.37143 XP_522693.3.37143 ENSPTRP00000010126 ENSPTRP00000010126 9598.ENSPTRP00000010126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]