SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q8C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q8C5
Domain Number 1 Region: 115-247
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.61e-46
Family Galectin (animal S-lectin) 0.00000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2Q8C5
Sequence length 250
Comment (tr|H2Q8C5|H2Q8C5_PANTR) Galectin {ECO:0000256|RuleBase:RU102079} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0002488 OC=Catarrhini; Hominidae; Pan.
Sequence
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPRQAPP
GAYPGAPGAYPGAPASGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNL
PLPGGVVPRMLITILGSVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLAISGDI
DLTSASYTMI
Download sequence
Identical sequences H2Q8C5
XP_001148424.2.37143 XP_009426120.1.37143 XP_009426121.1.37143 9598.ENSPTRP00000010805 ENSPTRP00000010805 ENSPTRP00000010805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]