SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q953 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q953
Domain Number 1 Region: 955-1169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-107
Family Thrombospondin C-terminal domain 0.00000000111
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-39
Family Laminin G-like module 0.00000000463
Further Details:      
 
Domain Number 3 Region: 832-953
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.93e-37
Family TSP type-3 repeat 0.000000129
Further Details:      
 
Domain Number 4 Region: 489-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.49e-17
Family TSP-1 type 1 repeat 0.0000131
Further Details:      
 
Domain Number 5 Region: 435-484
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.79e-16
Family TSP-1 type 1 repeat 0.0000342
Further Details:      
 
Domain Number 6 Region: 764-834
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000772
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 7 Region: 317-374
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000387
Family VWC domain 0.0077
Further Details:      
 
Domain Number 8 Region: 691-775
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000327
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 9 Region: 379-428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 10 Region: 547-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000023
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2Q953
Sequence length 1170
Comment (tr|H2Q953|H2Q953_PANTR) Thrombospondin 1 {ECO:0000313|EMBL:JAA43410.1, ECO:0000313|Ensembl:ENSPTRP00000011794} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0033446 OC=Catarrhini; Hominidae; Pan.
Sequence
MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEYATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMFRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP
Download sequence
Identical sequences H2Q953
XP_016783411.1.37143 XP_510294.3.37143 9598.ENSPTRP00000011794 ENSPTRP00000011794 ENSPTRP00000011794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]