SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q996 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q996
Domain Number 1 Region: 19-213
Classification Level Classification E-value
Superfamily L domain-like 4.15e-40
Family Internalin LRR domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2Q996
Sequence length 239
Comment (tr|H2Q996|H2Q996_PANTR) Leucine rich repeat containing 57 {ECO:0000313|EMBL:JAA01821.1, ECO:0000313|Ensembl:ENSPTRP00000011913} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0033570 OC=Catarrhini; Hominidae; Pan.
Sequence
MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGK
FTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL
GALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKI
LRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFA
Download sequence
Identical sequences A0A024R9M3 G3R2C6 H2Q996 Q8N9N7
gi|194394161|ref|NP_694992.2| ENSGGOP00000009373 ENSGGOP00000009373 9598.ENSPTRP00000011913 9606.ENSP00000326817 ENSPTRP00000011913 NP_694992.2.87134 NP_694992.2.92137 XP_003314701.1.37143 XP_004056100.1.27298 XP_008971429.1.60992 XP_008971435.1.60992 ENSP00000326817 ENSPTRP00000011913 ENSP00000326817 ENSP00000380319 ENSP00000455445 ENSP00000326817 ENSP00000380319 ENSP00000455445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]