SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q9G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q9G3
Domain Number 1 Region: 12-323
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-81
Family Protein kinases, catalytic subunit 0.000000758
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2Q9G3
Sequence length 721
Comment (tr|H2Q9G3|H2Q9G3_PANTR) Mitogen-activated protein kinase 6 {ECO:0000313|EMBL:JAA00699.1, ECO:0000313|Ensembl:ENSPTRP00000012102} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0008556 OC=Catarrhini; Hominidae; Pan.
Sequence
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS
TEPCWQYSDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQ
HEPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSG
GEDCFFINQFCEVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEG
FLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHL
N
Download sequence
Identical sequences G1R3W5 H2Q9G3 Q16659
ENSPTRP00000012102 NP_002739.1.87134 NP_002739.1.92137 XP_005254594.1.92137 XP_005254595.1.92137 XP_005254596.1.92137 XP_008951419.1.60992 XP_009427409.1.37143 XP_009427410.1.37143 XP_011520084.1.92137 XP_012362879.1.23891 XP_510409.2.37143 gi|4506091|ref|NP_002739.1| ENSP00000261845 ENSPTRP00000012102 ENSP00000261845 9598.ENSPTRP00000012102 9606.ENSP00000261845 ENSP00000261845 ENSNLEP00000007887 HR3573 hsk003000011.1 ENSNLEP00000007887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]