SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QC74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QC74
Domain Number 1 Region: 60-337
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-89
Family Protein kinases, catalytic subunit 0.00000000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2QC74
Sequence length 344
Comment (tr|H2QC74|H2QC74_PANTR) Aurora kinase B {ECO:0000313|EMBL:JAA02275.1, ECO:0000313|Ensembl:ENSPTRP00000014877} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0021095 OC=Catarrhini; Hominidae; Pan.
Sequence
MAQKENAYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRCNVQPTAAPGQKVMEN
SSGTPNILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSRTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRTHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPTGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Download sequence
Identical sequences H2QC74
9598.ENSPTRP00000014877 ENSPTRP00000014877 XP_016787933.1.37143 XP_016802258.1.37143 ENSPTRP00000014877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]