SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QCL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QCL9
Domain Number 1 Region: 257-424
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-42
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 20-91
Classification Level Classification E-value
Superfamily RING/U-box 2.78e-16
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2QCL9
Sequence length 436
Comment (tr|H2QCL9|H2QCL9_PANTR) Ring finger protein 135 {ECO:0000313|EMBL:JAA11045.1, ECO:0000313|Ensembl:ENSPTRP00000015306} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0028564 OC=Catarrhini; Hominidae; Pan.
Sequence
MAGLGLGPGPGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARGARR
WACPTCRQGAAQQPQLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSPRSSAAARP
RRRPELQRVAVEKSVTEVGQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSS
GVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEKLQENVTRKEAPEAQMQGELLEAPSSS
SCPLPDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCER
FSTSQVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQ
LSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWL
YGLHPGNYLIIKQVKV
Download sequence
Identical sequences H2QCL9
ENSPTRP00000015306 XP_001174802.1.37143 9598.ENSPTRP00000015306 ENSPTRP00000015306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]