SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QEG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QEG2
Domain Number 1 Region: 40-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000641
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2QEG2
Sequence length 300
Comment (tr|H2QEG2|H2QEG2_PANTR) Tubulin polyglutamylase complex subunit 2 {ECO:0000313|Ensembl:ENSPTRP00000016969} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0019449 OC=Catarrhini; Hominidae; Pan.
Sequence
MEEEASSPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDEHIIPLGSMAINSISKLTQLTQSSMYSLPNAPTLAD
LEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPITYNTNLLTEETD
SFVNKLDPSKVFKSKNKIVIPKKKGPVQPAGGQKGPSGPSGPSTSSTSKSSSGSGNPTRK
Download sequence
Identical sequences H2QEG2 Q68CL5
ENSP00000335144 ENSPTRP00000016969 ENSP00000335144 9598.ENSPTRP00000016969 9606.ENSP00000335144 NP_056291.2.87134 NP_056291.2.92137 XP_001140586.1.37143 XP_003830264.1.60992 gi|68534957|ref|NP_056291.2| ENSPTRP00000016969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]