SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QFL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QFL8
Domain Number 1 Region: 1779-2024
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.68e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 1109-1250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000322
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 510-624
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000746
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 388-511
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000108
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 607-731
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000377
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 236-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000155
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 810-928
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 8 Region: 920-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000097
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 9 Region: 158-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 10 Region: 1080-1123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000173
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 274-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 12 Region: 1338-1374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000005
Family EGF-type module 0.016
Further Details:      
 
Domain Number 13 Region: 1001-1041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000639
Family EGF-type module 0.017
Further Details:      
 
Domain Number 14 Region: 1467-1500
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 15 Region: 773-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000102
Family EGF-type module 0.014
Further Details:      
 
Domain Number 16 Region: 311-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 17 Region: 1248-1296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000246
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 121-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000283
Family EGF-type module 0.017
Further Details:      
 
Domain Number 19 Region: 42-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.038
Further Details:      
 
Domain Number 20 Region: 353-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.017
Further Details:      
 
Domain Number 21 Region: 735-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000357
Family EGF-type module 0.012
Further Details:      
 
Domain Number 22 Region: 963-1006
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000686
Family EGF-type module 0.011
Further Details:      
 
Domain Number 23 Region: 198-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000795
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 24 Region: 1386-1418
Classification Level Classification E-value
Superfamily Notch domain 0.00000101
Family Notch domain 0.0014
Further Details:      
 
Domain Number 25 Region: 1426-1458
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0049
Further Details:      
 
Domain Number 26 Region: 1048-1088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000822
Family EGF-type module 0.036
Further Details:      
 
Domain Number 27 Region: 80-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000162
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  H2QFL8
Domain Number - Region: 1291-1325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0179
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2QFL8
Sequence length 2321
Comment (tr|H2QFL8|H2QFL8_PANTR) Notch 3 {ECO:0000313|EMBL:JAA03144.1, ECO:0000313|Ensembl:ENSPTRP00000018116} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0026256 OC=Catarrhini; Hominidae; Pan.
Sequence
MGPGARGRRRRRRPMSPPPPPPPVRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPS
REAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLP
DPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGS
FRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDC
PGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC
VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC
HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCG
RGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVN
GGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGT
LCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL
VDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINE
CASSPCGEGGSCMDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVC
EPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPC
EHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGG
YTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGT
CTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQ
HEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCVQTGA
YCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQVGGQCVDEDSSHYCVCPEGRTGSH
CEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDL
VARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGL
RCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQ
CRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCACPPGLS
GPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQGWTGPRCEAPAAAPE
VSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNS
RCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC
ASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHR
PSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERL
DFPYPLRDVRGEPLEPPEPSVPLLPLLVAGAVLLLVILVLGVMVARRKREHSTLWFPEGF
SLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMG
AEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCG
GALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLD
AGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEG
MVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAA
REGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLG
PLLCPPGAFLPGLKAAQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLS
PVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGCVLSL
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEE
YPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAM
ATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences H2QFL8
ENSPTRP00000018116 XP_003316212.1.37143 ENSPTRP00000018116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]