SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QFV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QFV9
Domain Number 1 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.17e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 6 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 581-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.23e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-19
Family KRAB domain (Kruppel-associated box) 0.00041
Further Details:      
 
Domain Number 9 Region: 193-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.92e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 10 Region: 163-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 11 Region: 87-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000645
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 12 Region: 138-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000842
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2QFV9
Sequence length 642
Comment (tr|H2QFV9|H2QFV9_PANTR) Zinc finger protein 14 {ECO:0000313|Ensembl:ENSPTRP00000018337} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=ZNF14 OC=Catarrhini; Hominidae; Pan.
Sequence
MDSVSFEDVAVNFTLEEWALLDSSQKKLYEDVMQETFKNLVCLGKKWEDQDIEDDHRNQG
KNQRCHMVERLCESRRGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFMHHSSLNR
HMRSHTGQKPNEYQEYEKQPCKCKAVGKTFSFRHCFRKHERTHTGVKPYECKQCGKAFIY
YQPFQRHERTHAGEKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQCGKAFICYQSFQR
HKRTHTGEKPYECKQCGKAFSCPTYFRTHERTHTGEKPYKCKECGKAFSFLSSFRRHKRT
HSGEKPYECKECGKAFFYSASFRAHVITHTGARPYKCKECGKAFNSSNSCRVHERTHIGE
KPYECKRCGKSFSWSISLRLHERTHTGEKPYECKQCHKTFSFSSSLREHETTHTGEKPYE
CKQCGKTFSFSSSLQRHERTHNAEKPYECKQCGKAFRCSSYFRIHERSHTGEKPYECKQC
GKVFIRSSSFRLHERTHTGEKPYECKLCGKTFSFSSSLREHEKIHTGNKPFECKQCGKAF
LRSSQIRLHERTHTGEKPYQCKQCGKAFISSSKFRMHERTHTGEKPYRCKQCGKAFRFSS
SVRIHERSHTGEKPYECKQCGKAFISSSHFRLHERTHMEEKV
Download sequence
Identical sequences H2QFV9
XP_003316272.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]