SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QG91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QG91
Domain Number 1 Region: 186-323
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-48
Family Galectin (animal S-lectin) 0.0003
Further Details:      
 
Domain Number 2 Region: 11-157
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.64e-48
Family Galectin (animal S-lectin) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2QG91
Sequence length 323
Comment (tr|H2QG91|H2QG91_PANTR) Galectin {ECO:0000256|RuleBase:RU102079} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0030374 OC=Catarrhini; Hominidae; Pan.
Sequence
MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDI
AFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNP
FYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPPRPQGPPMMPPYPGPGHCHQQLNSLP
TMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAIDFKVGSSGDIALHINPR
MGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHR
LSAFQRVDTLEIQGDVTLSYVQI
Download sequence
Identical sequences H2QG91
9598.ENSPTRP00000018756 ENSPTRP00000018756 ENSPTRP00000018756 XP_512641.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]