SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QHD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QHD7
Domain Number 1 Region: 2-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.15e-56
Family Allantoicase repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 188-369
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-49
Family Allantoicase repeat 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2QHD7
Sequence length 391
Comment (tr|H2QHD7|H2QHD7_PANTR) Allantoicase {ECO:0000313|Ensembl:ENSPTRP00000019981} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0009902 OC=Catarrhini; Hominidae; Pan.
Sequence
MNMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHD
WCVLRLGIQGVIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGIRTGAAATPEE
FEAIAELKSDDWSYLVPMTALKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVF
GTGQKDWTATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRL
DRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQ
EEEAVIKQKWILPAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSR
LRLWGFPSSICLLRPREKPMMKFSVGFKANP
Download sequence
Identical sequences H2QHD7
ENSPTRP00000019981 ENSPTRP00000019981 XP_525676.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]