SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QHW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QHW6
Domain Number 1 Region: 346-649
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.78e-55
Family Rhodopsin-like 0.001
Further Details:      
 
Domain Number 2 Region: 21-246
Classification Level Classification E-value
Superfamily L domain-like 4.08e-44
Family Ngr ectodomain-like 0.00000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2QHW6
Sequence length 695
Comment (tr|H2QHW6|H2QHW6_PANTR) Follitropin receptor {ECO:0000256|RuleBase:RU361222} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0028095 OC=Catarrhini; Hominidae; Pan.
Sequence
MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAVELRFVLTKLRV
IQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
NLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKN
GIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLEN
LKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQE
VDYMTQARGQRASLAEDNESSYSRGFDMTYIEFDYDLCNEVVDVTCSPKPDAFNPCEDIM
GDNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIAS
VDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCK
VQLRHAASVMVMGWVFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVL
AFVVICGCYIHMYLTVRNPNIVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVP
LITVSKAKILLVLFYPINSCANPFLYAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETSS
TAHNTHPRNGHCSSAPRVTNGSTYILVPLSHLAQK
Download sequence
Identical sequences H2QHW6
XP_525753.2.37143 ENSPTRP00000020457 ENSPTRP00000020457 9598.ENSPTRP00000020457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]