SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QLK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QLK6
Domain Number 1 Region: 55-832
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.4e-276
Family Motor proteins 3.22e-16
Further Details:      
 
Domain Number 2 Region: 833-958
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.88e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 953-1069
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.72e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1239-1346
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.18e-17
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 1057-1148
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000209
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1511-1624
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000392
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 7 Region: 1345-1447
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000262
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 8 Region: 1756-1857
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000053
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2QLK6
Sequence length 1957
Comment (tr|H2QLK6|H2QLK6_PANTR) Myosin heavy chain 9 {ECO:0000313|Ensembl:ENSPTRP00000024645} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=MYH9 OC=Catarrhini; Hominidae; Pan.
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMIVCPPGAESSPGTENTKKV
IQYLAYVASSHKSKKDQVSAAGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINF
DVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFL
SNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTDQA
SMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYE
RMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHT
MFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPVSPPGILALLDEECWFPKATDKSFV
EKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQS
SDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRN
TNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEI
LTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVI
IGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQ
EEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELR
ARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQ
LEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKN
KHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEE
ELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEA
LKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAE
QLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNE
GERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQ
KLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETA
EEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQ
KKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFR
TEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQ
AMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLE
AHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMI
QLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQG
NTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKS
KYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKD
QADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRR
GDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences H2QLK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]