SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QLM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QLM3
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-46
Family Galectin (animal S-lectin) 0.000000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2QLM3
Sequence length 132
Comment (tr|H2QLM3|H2QLM3_PANTR) Galectin {ECO:0000256|RuleBase:RU102079} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=LGALS2 OC=Catarrhini; Hominidae; Pan.
Sequence
MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESIIVCNSL
DGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSIR
GGFNMSSFKLKE
Download sequence
Identical sequences H2QLM3
9598.ENSPTRP00000024695 XP_003821612.1.60992 XP_009436627.1.37143 XP_525588.2.37143 ENSPTRP00000024695 ENSPTRP00000024695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]