SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QLQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2QLQ5
Domain Number - Region: 168-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0425
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2QLQ5
Sequence length 533
Comment (tr|H2QLQ5|H2QLQ5_PANTR) Mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase {ECO:0000313|Ensembl:ENSPTRP00000024801} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=MGAT3 OC=Catarrhini; Hominidae; Pan.
Sequence
MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFFWNNAPVTPQA
SPEPGGPDLLRTPLYSHSPLLQPLPPSKAAEELHRVDLVLPEDTTEYFVRTKAGGVCFKP
GTKMLERPPPGRPEEKPEGANGSSARRPPRYLLSARERTGGRGARRKWVECVCLPGWHGP
SCGVPTVVQYSNLPTKERLVPREVPRRVINAINVNHEFDLLDVRFHELGDVVDAFVVCES
NFTAYGEPRPLKFREMLTNGTFEYIRHKVLYVFLDHFPPGGRQDGWIADDYLRTFLTQDG
VSRLRNLRPDDVFIIDDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYGFFWKQPGTLE
VVSGCTVDMLQAVYGLDGIRLRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCS
WCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEH
MYAPKYLLKNYDRFHYLLDNPYQEPRSTAAGGRHHRGPEGRPPARGKLDETEV
Download sequence
Identical sequences H2QLQ5
ENSPTRP00000024801 XP_009436704.1.37143 XP_009436706.1.37143 XP_009436707.1.37143 XP_009436708.1.37143 XP_009436710.1.37143 XP_016794687.1.37143 XP_016794688.1.37143 9598.ENSPTRP00000024801 ENSPTRP00000024801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]