SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QM27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QM27
Domain Number 1 Region: 30-211
Classification Level Classification E-value
Superfamily TIMP-like 5.1e-68
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2QM27
Sequence length 224
Comment (tr|H2QM27|H2QM27_PANTR) TIMP4 isoform 1 {ECO:0000313|EMBL:PNI53347.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0025279 OC=Catarrhini; Hominidae; Pan.
Sequence
MPGSPRPAPSWVLLLRLLALLWPLGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPA
SADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQV
LSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTD
WLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
Download sequence
Identical sequences H2QM27
XP_516284.1.37143 ENSPTRP00000025243 ENSPTRP00000025243 9598.ENSPTRP00000025243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]