SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QMM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QMM7
Domain Number 1 Region: 18-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.35e-70
Family Protein kinases, catalytic subunit 0.000000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2QMM7
Sequence length 501
Comment (tr|H2QMM7|H2QMM7_PANTR) CaM kinase like vesicle associated {ECO:0000313|Ensembl:ENSPTRP00000025786} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0005076 OC=Catarrhini; Hominidae; Pan.
Sequence
MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLHTCKKFQKRDG
RKVRKAAKNEIGILKMVKHPNILQLVDVFVTRKEYFIFLELATGREVFDWILDQGYYSER
DTSNVVRQVLEAVAYLHSLKIVHRNLKLENLVYYNRLKNSKIVISDFHLAKLENGLIKEP
CGTPEYLAPEVVGRQRYGRPVDCWAIGVIMYILLSGNPPFYEEVEEDDYENHDKNLFRKI
LAGDYEFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGV
CAQIEKNFARAKWKKAVRVTTLMKRLRAPEQSSTAAAQSASATDTATPGAAGGATAAAAS
GATSAPEGDAARAAKSDNVAPADRSATPATDGSATPATDGSVTPATDGSITPATDGSVTP
ATDRSATPATDGRATPATEESTVPTTQSSATLATKAAATPEPAMAQPDSTAPEGATGQAP
PSSKGEEAAGYAQESQREEAS
Download sequence
Identical sequences H2QMM7
XP_003309921.1.37143 XP_008970495.1.60992 ENSPTRP00000025786 9598.ENSPTRP00000025786 ENSPTRP00000025786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]