SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QP32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QP32
Domain Number 1 Region: 277-325
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2QP32
Sequence length 331
Comment (tr|H2QP32|H2QP32_PANTR) Spondin 2, extracellular matrix protein {ECO:0000313|EMBL:JAA03968.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0041087 OC=Catarrhini; Hominidae; Pan.
Sequence
MENPSPAAALGKALCALLLATLGAAGQPLGGESVCSARAPAKYSITFTGKWSQTAFPKQY
PLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSV
HAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQA
ALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVT
LVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGPCGRLGTKS
RTRYVRVQPANNGSPCPELEEEAECVPDNCV
Download sequence
Identical sequences G3QJR7 H2QP32
ENSGGOP00000002670 ENSGGOP00000002670 XP_004038367.1.27298 XP_009445472.1.37143 XP_016808203.1.37143 ENSPTRP00000027253 ENSPTRP00000027253 9598.ENSPTRP00000027253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]