SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QPC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QPC0
Domain Number 1 Region: 773-954
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 2 Region: 159-192,231-377
Classification Level Classification E-value
Superfamily PH domain-like 9.1e-32
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 3 Region: 929-1048
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.05e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 4 Region: 3-163
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-21
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2QPC0
Sequence length 1168
Comment (tr|H2QPC0|H2QPC0_PANTR) TBC1 domain family member 1 {ECO:0000313|Ensembl:ENSPTRP00000027512} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=TBC1D1 OC=Catarrhini; Hominidae; Pan.
Sequence
MEPITFTARKHPLPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSTRKEPV
TKQVRLCVSPSGLRCEPEPGRSQQWDPLIYSSIFECKPQRVHKLIHNSHDPSYFACLIKE
DAVHRQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSGSRGSESPRPNPPHAAPTGSQEPGRRPMRKSFSQPG
LRSLAFRKELQDGGLRSSGFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALV
DEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQSLHKLCERIEGMNSSKTKLELQKHLTT
LTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHIHIGEMKQTSQMAAENI
GSELPPSATRFRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSTSVDLDSSLSSTLSN
TSKEPSVCEKEALPISESSFKLLGSSEDLSSDSESHLPEEPAPLSPQQAFRRRANTLSHF
PMECQEPPQPARGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHS
WRQQIFLRVATPQKACDSSSRYEDYSELGELPPRSPLEPVCEDGPFGPPPEEKKRTSREL
RELWQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLST
PGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKDVPYKELLKQ
LTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGIL
LLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEI
GPSLYAAPWFLTMFASQFPLGFVARVFDMIFLQGTEVIFKVALSLLGSHKPLILQHENLE
TIVDFIKSTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQRM
DKLEKTNSSLRKQNLDLLEQLQVANGRIQSLEATTEKLLSSESKLKQAMLTLELERSALL
QTVEELQRRSAEPSDREPECTQPEPTGD
Download sequence
Identical sequences H2QPC0
ENSPTRP00000027512 9598.ENSPTRP00000027512 XP_001137680.1.37143 ENSPTRP00000027512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]