SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QSH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QSH5
Domain Number 1 Region: 332-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-66
Family SPRY domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-19
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 3 Region: 156-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000186
Family C2 set domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2QSH5
Sequence length 584
Comment (tr|H2QSH5|H2QSH5_PANTR) Butyrophilin subfamily 3 member A3 {ECO:0000313|Ensembl:ENSPTRP00000030422} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0045424 OC=Catarrhini; Hominidae; Pan.
Sequence
MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSIGWYPQPQIKWS
DTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADP
FFRSAQPWIAALAGTLPISLLLLAGASYFLWRQQKEKIALSRETEREREMKEMGYAATEQ
EISLREKLQEELKWRKIQYMARGEKSLAYHEWKMALFKPADVILDPDTANAILLVSEDQR
SVQRAEEPRDLPDNPERFEWRYCVLGCENFTSGRHYWEVEVGDRKEWHIGVCSKNVERKK
GWVKMTPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEISFYNATDG
SHIYTFPHASFSEPLYPVFRILTLEPIALTICPIPKEVESSPDPDLVPDHSLETPVTPGL
ANESGEPQAEVTSLLLPAQPGAEVSPSATTNQNHKLQARTEALY
Download sequence
Identical sequences H2QSH5
9598.ENSPTRP00000030422 ENSPTRP00000030422 ENSPTRP00000030422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]