SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QUH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QUH8
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.9e-42
Family Cofilin-like 0.0027
Further Details:      
 
Domain Number 2 Region: 382-438
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-18
Family SH3-domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2QUH8
Sequence length 439
Comment (tr|H2QUH8|H2QUH8_PANTR) Drebrin like {ECO:0000313|Ensembl:ENSPTRP00000032682} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0031507 OC=Catarrhini; Hominidae; Pan.
Sequence
MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSG
KVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMANFLKGAHVTINARAE
EDVEPECIMEKVAKASGANYSFHKESGRFQDAGPQAPVGSVYQKTNAVSEIKRVGKDSFW
AKAEKEEENRRLEEKRRAEEAQRQLEQERRERELREAARREQRYQEQGGEASPQSRTWEQ
QQEVVSRNRNEQGSTCASLQESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLT
QPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLVQ
QQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRG
YGPDGHFGMFPANYVELIE
Download sequence
Identical sequences H2QUH8
ENSPTRP00000032682 ENSPTRP00000032682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]