SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QXC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QXC3
Domain Number 1 Region: 504-664
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.65e-44
Family MAM domain 0.00045
Further Details:      
 
Domain Number 2 Region: 167-327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-29
Family MAM domain 0.0031
Further Details:      
 
Domain Number 3 Region: 338-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-29
Family MAM domain 0.0019
Further Details:      
 
Domain Number 4 Region: 23-167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-22
Family MAM domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2QXC3
Sequence length 686
Comment (tr|H2QXC3|H2QXC3_PANTR) MAMDC2 isoform 1 {ECO:0000313|EMBL:PNI62021.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0017740 OC=Catarrhini; Hominidae; Pan.
Sequence
MLLRGVLLALQALQLAGALDLPAGSCAFEESTCGFDSVLASLPWILNEEGHYIYVDTSFG
KQGEKAVLLSPDLQAEEWSCLRLVYQITTSSESLSDPSQLNLYMRFEDESFDRLLWSAKE
PSDSWLIASLDLQNSSKKFKILIEGVLGQGNTASIALFEIKMTTGYCIECDFEENHLCGF
VNRWNPNVNWFVGGGSIRNVHSILPQDHTFKSELGHYMYVDSVYVKHFQEVAQLISPLTT
APMAGCLSFYYQIQQGNDNVFSLYTRDVAGLYEEIWKADRPGNAAWNLAEVEFNAPYPME
VIFEVAFNGPKGGYVALDDISFSPVHCQNQTELLFSAVEASCNFEQDLCNFYQDKEGPGW
TRVKVKPNMYRAGDHTTGLGYYLLANTKFTSQPGYIGRLYGPSLPGNLQYCLRFHYAIYG
FLKMSDTLAVYIFEENHVVQEKIWSVLESPRGVWMQAEITFKKPMPTKVVFMSLCKSFWD
CGLVALDDITIQLGSCSSSEKLPPPPGECTFEQDECTFTQEKRNRSSWHRRRGETPTSYT
GPKGDHTTGVGYYMYIEASHMVYGQKARLLSRPLRGVSGKHCLTFFYHMYGGGTGLLSVY
LKKEEDSEESLLWRRRGEQSISWLRALIEYSCERQHQIIFEAIRGVSIRSDIAIDDVKFQ
AGPCGEMEDTTQQSSGYSEDLNEIEY
Download sequence
Identical sequences H2QXC3
NYSGRC-40538802 XP_520065.2.37143 ENSPTRP00000035909 9598.ENSPTRP00000035909 ENSPTRP00000035909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]