SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QXJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QXJ7
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily L domain-like 3.33e-29
Family U2A'-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2QXJ7
Sequence length 251
Comment (tr|H2QXJ7|H2QXJ7_PANTR) Acidic nuclear phosphoprotein 32 family member B {ECO:0000313|Ensembl:ENSPTRP00000036180} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0043907 OC=Catarrhini; Hominidae; Pan.
Sequence
MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNL
PKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDL
FNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEGEDEEDE
EDEDGEEEEFDEEDDEDEDVEGDEDDDEVSEEEEEFGLDEEDEDEDEDEEEEEGGKGEKR
KRETDDEGEDD
Download sequence
Identical sequences A0A0D9REY3 A0A2K5JGL6 A0A2K6Q8J8 G1S4Y8 H2PSU9 H2QXJ7
XP_001156957.1.37143 XP_002820066.1.23681 XP_003260592.1.23891 XP_007966818.1.81039 XP_010355939.1.97406 XP_011794866.1.43180 XP_017743073.1.44346 ENSNLEP00000020576 ENSPTRP00000036180 ENSPPYP00000021773 9598.ENSPTRP00000036180 9600.ENSPPYP00000021773 ENSPPYP00000021773 ENSPTRP00000036180 ENSNLEP00000020576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]