SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QZS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QZS3
Domain Number 1 Region: 571-634
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000987
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 499-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000123
Family TSP-1 type 1 repeat 0.00066
Further Details:      
 
Domain Number 3 Region: 626-682
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000292
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  H2QZS3
Domain Number - Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000101
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number - Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2QZS3
Sequence length 843
Comment (tr|H2QZS3|H2QZS3_PANTR) Complement component 7 {ECO:0000313|EMBL:JAA18409.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0035935 OC=Catarrhini; Hominidae; Pan.
Sequence
MKVISLFILVGFIGEFQSFSSASSPVNCQWDSYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCAGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRTSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKCSFFRSSSSSSRSYTSHTN
EIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRSLIDQYG
THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENAL
KAASGTQNNVLRGDPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE
CGPSLDVCARDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAV
ETQ
Download sequence
Identical sequences H2QZS3
9598.ENSPTRP00000039456 XP_001138984.2.37143 ENSPTRP00000039456 ENSPTRP00000039456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]